dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F6CM12 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F6CM12|F6CM12_DESK7) Putative transcriptional regulator, CopG family {ECO:0000313|EMBL:AEG14155.1} KW=Complete proteome; Reference proteome OX=760568 OS=Desulfotomaculum kuznetsovii (strain DSM 6115 / VKM B-1805 / 17). GN=Desku_0538 OC=Desulfotomaculum.
Sequence length 89
Sequence
MAQVKRIMISLPDNLLAEVDGIVAAERLNRSELIREAMRFYIAERKRRQLREQMKKGYQE
MAKINRELAAEHYRLEAEAVGQYEKAEVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]