dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F8DBD3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F8DBD3|F8DBD3_HALXS) Heme NO binding domain protein {ECO:0000313|EMBL:AEH35914.1} KW=Complete proteome; Reference proteome OX=797210 OS=Halopiger xanaduensis (strain DSM 18323 / JCM 14033 / SH-6). GN=Halxa_1281 OC=Halopiger.
Sequence length 185
Sequence
MHGIVLKGLKDFVTEEYGADVWTDLHEAAGFRTRLYVPVTEYPDEIVLELVDAATDLTGL
EEPTLLAAFGRFLVPHLLSTYGVHVDREWTGLELIANVETYIHEALRAKQSGEFTPPELR
TRRVDDRRVALAYESDRGLCALARGLLEGIADYYDEPLHIEQRRCMHEGADCCVFVVTRR
RAGAV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]