dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F8DG74 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F8DG74|F8DG74_STREP) Sugar isomerase, AgaS family {ECO:0000313|EMBL:AEH56553.1} KW=Complete proteome OX=760570 OS=/ LMG 14537). GN=HMPREF0833_11522 OC=Streptococcus.
Sequence length 389
Sequence
MLDYTKEDLQELGAEITSREIYQQPSVWKETARLYQERKAEIKAFLEKIGQEYDYIKVIL
TGAGTSAYVGDTLVPYLQEVHDERHWNFQSIATTDIVAHPQTYLKKEVPTVLVSFARSGN
SPESVATVQLAQDLVDELYQITITCAEEGKLAQQAHGDERNLLFLQPKETNDAGFAMTSS
FTSMLLTALLVFDPSEEEIKENRVSELVHLSEQILEKDREVKEVVDLDFERVIYLGAGPF
FGLAHEAQLKILELTAGKIATMYESPVGFRHGPKSLINDQTLVLVFGSIDPYTRQYDLDL
VREVAGDQIARQVVLLTDQVAGIEHVREVLVEASADSLDIYRAFPYIIYGQLISLLTSLK
VQNRPDTPSPTGTVNRVVQGVIIHSFHKE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]