dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F8FVP5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F8FVP5|F8FVP5_PSEP6) Glutathione S-transferase domain-containing protein {ECO:0000313|EMBL:AEJ10746.1} KW=Complete proteome OX=1042876 OS=Pseudomonas putida (strain S16). GN=PPS_0157 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 220
Sequence
MLKLHGFSVSNYYNMVKLALLEKGLPFEEITFYGGQAPQALEVSPRGKVPVLQTEHGFLS
ETSVILDYIEQTQGGKALLPADPFGQAKVRELLKEIELYIELPARTCYAESFFGMSVEPL
VKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCFSVDLAYAVGKKVLNIDFLAD
FPQAKALLQLMGENPHMARIVADKEAAMPAFMEIIRSGKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]