dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F8FWX0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F8FWX0|F8FWX0_PSEP6) Putative lipoprotein {ECO:0000313|EMBL:AEJ10772.1} KW=Complete proteome OX=1042876 OS=Pseudomonas putida (strain S16). GN=PPS_0185 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 244
Sequence
MNTTPSSRINPWLSLLMAACLAFTGCASTGSSLTGGGGTADPRLTTGNDAKFFSTSGFQA
CALAAGGGILACMLSNSGNKAACSIIAGVAACGVAMGANYYLDQRRAKYADTTERLNAMT
TEVQGETAKVAERTNTLQRVINDDKEQIASIQNSIKAKTIDMAKAQQDIANIDQNISLMR
KDLNNMKTRVTEYQQVAKLERDGGASPAEVQKVEAEIAKMNTKVASLQQEVDGLYNQRSA
ITLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]