dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F8G6I2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F8G6I2|F8G6I2_PSEP6) 4-hydroxy-tetrahydrodipicolinate reductase {ECO:0000256|HAMAP-Rule:MF_00102, ECO:0000256|SAAS:SAAS00018068} KW=Complete proteome OX=1042876 OS=Pseudomonas putida (strain S16). GN=PPS_4571 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 268
Sequence
MRRIAVMGAAGRMGKTLVEAVQQQAPQAGLTAAIDRPDSSLVGADAGELAALGRIGVPIS
DDLSKVVDEFDVLIDFTHPSVTLKNLAFCRKAGKAMVIGTTGFTPEEKQQLAEAGKEIPI
VFAANFSVGVNLCLKLLDTAARVLGDDVDIEILEAHHRHKVDAPSGTALRMGEVVAQALG
RNLQEVAVYGREGQTGARERQTIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTF
AKGAVRAALWLDGREPGLYDMQDVLELR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]