dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0GCV8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0GCV8|G0GCV8_SPITZ) Uncharacterized protein {ECO:0000313|EMBL:AEJ61250.1} KW=Complete proteome; Reference proteome OX=869211 OS=Spirochaeta thermophila (strain ATCC 700085 / DSM 6578 / Z-1203). GN=Spith_0977 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Spirochaeta.
Sequence length 977
Sequence
MGVRLLLWCLLVFLVGGVVYAGGQGEDELEMARRLIEEKRYNRAIEIITQVMREDPDRME
EAEALLARVRMVRGDFNALYAELIEVLYVQRDVERALEIIEELEGMDEEPDPAVRESLAR
AKETARFVYNQDRFRGIMEEGARLLDAGRYAEAVRLYQEGFGLYREEFFSSQYGNVILDE
VGRVVSRLEGVAGGLSEVLADFEDAWKGYAAVVEGGGVDEVVEGYAALREAAFRLAAARR
EVFRLGRVVAWENLRVMESAGLEREDFFLGFMQRFVLGRVQVREREGVVGALERALLEGL
GGVSAGLERRLEGVVQEGFGGAEVWEDAMRLAGVMVRLQECWGASGVWERGGMGDWEREI
VGRGGRTVLVGRAYGAVAGAMGRLREVLGVGVLEGDVDVRLAAVRERVAGVWGVMGELEE
MAGVFEGRFGAFGGRDAARVVEGAVRYLEGVAGEEERRAVRVVVEALAGDVGRMEEGVRE
VAAMVQGVRELLEGREEEVEVGGTLQTVLAKYPREALALAEEAEQALQGYLSFHASRSRV
YAAMEEYLRTDEGVERLVAGFDSSAEEARALLETLQGLKGQAREQSLLAERYRNEGLKKL
RDAERAIDREAYEEARTLLSEAGELFATSFSYQEDMELRREVDARLIALSERIVSEENQR
IIREVRSLITQGREQYLLGNFEEAERLLLRAQARWRVTHTEDNEEVVYWLKFVRAALAIQ
RGRTISETDPLYSEITQLLNLARQDYQRASTLIEGGRRDEGMGLLDQAVEKLLRVRMAFP
LNRDASILLLRIEQLRNPDNFDALFRRRIDESIAKLNTAPQEAYVELQDLAAIRPDFPGL
KDAIYRAEITLGVRVPPPDPRNIARAKELYVQALDIFNRNDRANFPVALEQLNQAITLDP
DNQDAVALKDRIQLAMGAQTTVTLPSYALRRYKEAEQKYVEGRYYEALAIVQELLADERA
KRYPPLLELKRRIESRL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]