dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0HTT2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0HTT2|G0HTT2_HALHT) Phosphoribosylaminoimidazole-succinocarboxamide synthase {ECO:0000313|EMBL:AEM56142.1} KW=Complete proteome OX=634497 OS=102182 / NCIMB 2187 / VKM B-1755). GN=HAH_0517 OC=Haloarcula.
Sequence length 344
Sequence
MTSVKEFRVDEPATAEDLGRGAFVFTDDYSVFDWGKMPDRIPDKGASLCTMGAYNFQLLE
ENHVPTHYEGVRLPDSDEVLDLGEALSADAAPEEMVIELTQVPDLPFEDGRYDYDAYHGA
ADENYLIPLEIVFRNRVGVGSSLRSRTEPADHGLDYDTWPEEVVDLDEPIVEFSTKYEEQ
DRYLDREAADRIAGTASIDRLEELARAVNHIVTQQAAEADLVHEDGKIECLYYDGEIRVA
DVVGTFDENRFSYGGQQVSKEVIRQYHKRTQPEWVEAVSEAKEQADAESVADWKSLCAES
PEPLDEDVIQVARDLYCAGTNAYIGGDVFDAPSLDEAVSAAGEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]