dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0LCE7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0LCE7|G0LCE7_ZOBGA) Ribosomal protein L11 methyltransferase {ECO:0000313|EMBL:CAZ96929.1} KW=Complete proteome; Reference proteome OX=63186 OS=NCIMB 13871 / Dsij). GN=zobellia_2781 OC=Flavobacteriaceae; Zobellia.
Sequence length 278
Sequence
MSNTIYIEYNFSVSPLQPGSDILIAELGEAGFESFVENEEGVLAYIQKEDWNENILETVE
ILDNSIFEVGFSIKEIEQENWNATWEKNFEAIQVADQCVVRAPFHEKPDVAFDIVIEPKM
SFGTGHHETTYMMLQFVLENDFEGKDVLDMGSGTGVLAILAALKKAAHIDAIDIDNWCYL
NAKENVERNNCSHISVFEGDSSLLGERKYNVILANINRNILLADIPVYAQNLRENGALFL
SGFYEEDIPLISETCLKAGLKFEKNLQKNNWVAVKYVF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]