dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0LID2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0LID2|G0LID2_HALWC) DUF814 domain protein {ECO:0000313|EMBL:CCC39852.1} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_1937 OC=Haloquadratum.
Sequence length 719
Sequence
MDPKQELTSVDIAALVTELRRYTGAKVDKTYRYGDDLLRFRMRDFDRGRLELLIEVGTQK
RIHTADPDHVPDAPERPPNFAMMLRNRLSGADLVNVEQFEFDRIMILSFERGEEMTRIIV
ELFGDGNVAVVDSAGEVIQSLETVRLKSRTVAPGAQYEFPDSRVNPLQVTYDRFVSLMNE
SDTDIVRTLATQLNLGGLYAEEVCARAGIDKTTQITNTSDKIYRAIYTALESLGTQLQSG
DFEPRLYADDDAVIDATPFPLEERKQQNLDVTAYDSFNGALDVYFREVDRNPAAEESGQT
RPDFAAEIAKKQRIIEQQEGAIDDFEQRAEAERSRAELLYANYELVNEIIETIQTARAED
TSWDEIRETFAMGAERGIDAAAAVVSVDGAEAMVTIEIDDVRVPVNVDVGVEKNADQRYT
EAKRIEEKKEGALTAIENTREELNAVKQRRDAWDREDAKPDTEDNADNTETVTDKVNTGT
EPSRMGPTNDEWLSMTSIPLQKNDDWYEQFRWFHTSTGYLVVGGRNADQNETLVKKYLNK
HDRFFHTEAHGGPITILKASGPSEPAEPIELTAETRREVAQFAISYSSIWKEGRYADDAY
VVTPDQVSKTPESGEYIEKGSFVIRGDRTYIRDVAAEIAVGIQCADETQVIGGPPSAIAD
RVPTMVQVRPGRYAQNDAAKLAYREFRNRFADESFVRKIASPDKIQEFLPPGGSDLVDE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]