dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0LM10 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0LM10|G0LM10_HALWC) 30S ribosomal protein S13 {ECO:0000256|HAMAP-Rule:MF_01315} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_3359 OC=Haloquadratum.
Sequence length 173
Sequence
MSANNTQDDAAEEEDDDLQYFVRIGTTDLDGTKAVERSLTDMKGIGKRTARIITDVASVD
RHATFGLLEEDEIDSITDAVENLDDHIPGWMTNRREDFFSGDTDHKTGADLEEKRRHDVN
RMKMIDSYKGVRHKRGQKVRGQRTKSTGRTEGTIGVNVEAIKEEAAEAAEEEE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]