dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0ME49 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0ME49|G0ME49_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT51946.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_24018 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence length 403
Sequence
MVATRGPSTLQDAVDAAIELQPYADRPKDVAEDTANIKATVYNIEKCSEGERQRRRIHSP
KCHKDPSRFARSKCHECQKMGHISKYCYDKLGRKEAKRRMREDNVKSSRTWKPTKSFKQH
GADGRVSNGEQNEVTKLREQVRTLTLRNNQSAANRHDSREHASEVKQLEGNAVNIISQVP
IRANNISTAALLDTGANITVAGNQLCASLGISTLDQLGSGYATCLGSNPVAMAGTALVTL
KIGSRKYIHRVHFTDGPCTPGENGSYTIIIGNDLLQRMPMLRFDYQSKRVWIGKEALPLG
VRKSATKTSPPMVNQIVAKEDTTQAPTCMVIQLGPGVFTAHGPSKGFSRTGTTEEATADV
NKEEVTTLLEKKIIKDRKDKPAKEEKTGRRNPGRQGRAPARHL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]