dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0T249 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0T249|G0T249_RHOT2) Putative F-actin capping {ECO:0000313|EMBL:EGU11019.1} KW=Complete proteome; Reference proteome OX=1001064 OS=(Yeast) (Rhodotorula glutinis (strain ATCC 204091)). GN=RTG_03239 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence length 421
Sequence
MSDAQARLDAASTFLLQSPPGEVNDVLSDLRAILSSSGLSDSQIESGLLPALTKHNAEQF
TVVESEGKKVLVTPASRIEGASEEEEGTERHVEPREGKEFVFDHLKGLASSASPHTSPFD
AETSTLRISLDQLLSSYVSNHYASGVAAVYTLPDPAYPPPEPAPAAAPSTEETATEPEGT
GETGTIAQDVEGGKEEVADVAADTAEEAEKALPEEGVETVGGEGAEPTGVSAEEAEAGEK
AGEFEFEAVEEDKMDVGTPAAATTAAEEEEAPSATTENAAPVPPQPRPSRLFGLYFVGNK
YNPSNYWTGRWRSTYQLDYAKGTLEGTAQINIHYYEQGNVQLSTTLKSSATLSPSPSPES
VVASIKATESSFQRQLGETYNDLSDASFRGLRRALPNTRSKLDWDKATGMRLGQQIGGGA
Q

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]