dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G1N0A2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G1N0A2|G1N0A2_MELGA) EH domain binding protein 1 {ECO:0000313|Ensembl:ENSMGAP00000004815} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=EHBP1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence length 1175
Sequence
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQP
GIKNPYRGVVVWPVPENVEITVTLFKDPHAEEFEDKEWTFVIENESPSGRRKALATSSIN
MKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEEDEENRVNQEEKAAKITEIVNQLNALSSLDEDQDDCIKQANMPSAK
SASSSEELINKLNFLDKEEQDLADSSMNPFGDPDAAELNPFGDPDVEELDSEIASSSKAE
EGFYVDSYNPFKDEDAPEYLNPFDEPDPDPETFVTIRDSPPQPAKRKNVRPVDMSKYLYA
DTSKAEEEELDESNPFYEPKSSPALIKVGPLQEPEKKMKRRAPEPPNLLPKTETNMSENV
SAIPASRELSSSPKPSPIPSPVLGRKPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGL
SFCAILHHFRPDLINIQHRTLHKKQISVRFRKAYDGFASLGISRLLEPSDMVLLAIPDKL
TVMTYLYQIRAHFCGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELSDLKRQ
PELQAPDGGLADFASQDDSVFVNDSGVGESESEHQTPDDHLSPSTASPSSRRTRSDTDPQ
KSQQSSGRTSASEEVGKCSSTDTAQAQPVVGRKKLLKADTLDLSDLAHVSDQKEDVSPTI
ACEDNDKKRHQSSDNTVGFSEQKRLGHMGSPESVREDPGSRGMKQSLSPTSNLGYFYKDM
DLAKKTCTSPRQAESDSDSDARMTSNHADPAAKAAQQRMLSRQEELKERARVLLEQARRD
AALKAGNKQLTNTIIPARSKQLNDQQDEERRRQLRERARQLIAEARSGVKMSELPSYTEM
AAEKLKERSKASGDEDEDDDNIEIDTNEEVPECSVTGGGDELTNLENDLDSTEQNSKLVD
LKLKKTLETQPQVANSLSSAAQKAVTDSSEQDVKNGTEEHRAERLQKSAERFRNPVVFSK
DSTVRKTQLQSFSQYVESRPEMKRQRSIQEDTKRGNEEKAAITETQRKPSEDEVLNKGFK
DTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWFMLVNKKNA
LIRRMNQLSLLEKEHDLERRYELLNRELRAMLAIE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]