dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G1T276 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G1T276|G1T276_RABIT) Aldehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR036492} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=ALDH3A2 OC=Oryctolagus.
Sequence length 485
Sequence
MEREVQRLRRAFRSGRSRPLRFRLQQLEALRRMVQEREADILAAIAADLCKSELNAYSQE
VITILGEIDFMLNNLADWVTAKPVKKNLFTMLDEAYVQAEPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVILKPSELSEHTAQVLAKLLPQYLDQDLYAVVNGGVKETTELLKERFDH
ILYTGNAAVGRVVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDTVCRRITWGKYMNCGQT
CIAPDYVLCEASLQNHIVQKIKETVQEFYGENIKESPDYERIINLRHFKRIQSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPEAKVMQEEIFGPVLPIVPVKNADEAIQFINEREKPLA
LYIFSHNDKLIRRMIDETSSGGVTGNDVIMHFTLNSLPFGGVGHSGMGAYHGKHTFDTFS
HQRPCLLKSLKGESANKLRYPPNSQSKVDWAKFFLLKQFHKGKLGLLLLAVLGIVAALLV
KTGYY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]