dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G1TFQ7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G1TFQ7|G1TFQ7_RABIT) Uncharacterized protein {ECO:0000313|Ensembl:ENSOCUP00000015751} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=PRG4 OC=Oryctolagus.
Sequence length 884
Sequence
MEWKVLPVYLLLLLSVVLVDQVSSQDLPSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KKVCTVELSCKGRCFESFARGRECDCDAQCKKYGKCCSDYEKFCEEVHNPTSPPSSKPAP
PPPGASQTIKSTTKRSPKSPNKKKTKKVIESEEITEEHSVSENQATIRKIKSSKNSAANR
ELQKKPKVKDNKKKRTPKKEPAPKPPATDEAGSGLDSAPAPDIPTTPRSKVTTSPKTTTV
KPTNPKPSLPPKPKEKPSTSNKETTVKTKETTETNKQTSTSAKEKTASVKETRTAXPINP
KEPVPTTPKVAAPTNPKKPAPTTPKEPVPTTPLTPAPTTTMGAPTTKTPAESTPESSTGP
TPKVLENSPKQPAVPTTKTPGVIQSEMITTAKDKNTEKDIHTTPEMTTAATKTEDKTPEA
KITSTIRQVTSATTQDTTSFKVTTPKATTLAPKVTTSTKKTTTTEESANKSEVVTPAPKD
TATGAKATPSPPKPTKPSKKPTSTKKPTKVPKKPTSTKKPNTPKVKKPKTTPPLPKTTTP
TLSELNPASVAEAMLQATRSPTPTRDTETVEAHPKNEGAEEQEKPYVIPRPPGFIPILVP
GTEYIVRGPSDGIITNPMLSVLDETNLCNGKPVDGLTTLRNGTLVAFRGHYFWMLNPFSP
PSPPRRITDVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDIKDAGYPKQIVKGFGG
LTGKIVAALSIAKYKNRPESVYFFKRGGSIQQYTYKQEPVRKCTRRTPINYSVYGETAQI
RRRRFERALGPQTHTIRIHYSPVRVAYQDKGFLHNEVKVSTIWRGLPSVVTSAISLPNIR
KPDGYDYYAFSKDQYYNIDVPTRTARAITTRSGQTLSKIWYNCP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]