dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G1TM29 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G1TM29|G1TM29_RABIT) Aldehyde dehydrogenase family 16 member A1 {ECO:0000256|PIRNR:PIRNR036490} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=ALDH16A1 OC=Oryctolagus.
Sequence length 789
Sequence
MAATRVGPRACDIFTTMEYGPAPESHACALAWLDTQRHLGHYVDGKWLNPEHRSSVPCQD
PVTGENLATCLLAQAEDVCAAVEAARTSLESWSKLPGAARAQHLSRLAKMLQKHQRLLWT
LESLVTGRAVREVRDGDVSLAQQLLQYHAVQAHTQEEALAGWEPMGVIGLILPPTFSFIE
MMWRVCPALAVGESLSCPVPQAAPCPTAARRGRGPRGSPSFLEVGGVSVPRGPHLPFPSL
CASPHPTPPRCPGLAQSVSLALSLPLVFQLLSSPSEPHPPRVWASALCDPAGGLRLLIQE
SVWAETLRRLQARMGRLRSGRGLDGAVDMGARGAAARDLAQRYVREAESLGAQVFQAGDV
PSDGPFYPPTLVSGLPPAAPCAQAEVPWPLVVASPFRTAKEALAMANATPRGGSGSVWSE
RLGQALELGHGLQVGTVWINSHGLRDPGVPTGGCKESGSSWHGGPDGLYEYLRPPGTPAR
LPAPSENLNYDTFGLTVPSTLPAGPEAGPSPAPPYGLFVGGRFQAPGARSSRPIPGADGS
LHGYVAEGGAKDIRGAVEAAHQAAPGWVGRSPGARAAVLWALAAALERRAPTLTSRLERH
GVGLKAAKAEVELSARRLRTWGARAQAQGHSLQVAGLRGPVLRLREALGVLAIVCPEEWP
LLAFVSLLAPALAHGNALVVVPSGACPLLALELCQDMATLLPAGLVNVVTGDRDHLTRCL
ALHQDIQALWYFGSAQGSRFAEWASAGNLKAVWANAGHPRAWDQEAEGAGPELGLRAART
KALWLPAGD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]