dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G3V7M2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G3V7M2|G3V7M2_RAT) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_50718 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence length 807
Sequence
MVDSSTVLIFLLVLGGGQSELDTKITSSGETTEWEDPDLSPQGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPEQELEEPRGHQEVLQDRPLSQGDRGEGA
TQLAPQRIRVTLRPGEPQKFRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGQALLL
RLREVTHSVRIGFGSFVDKTVLPFVSTVPSKLNHPCPSRLERCQAPFSYHHVLPLTRDAQ
AFEREVGRQNVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGRCHLDSNGVYTNSAEFDYPSVGQVAQALTAANIQPIFAVTGATLPVYQELS
QLIPKSAVGELSEDSSNVVQLIMDAYDNLSSTVTLEHSSLPPGVSISFESHCRSPEKSEG
EAGDRRGQCNHVRVNQMVDFWVTLQASHCLPEAHVLRLWALGFSEELTVELHTLCDCNCS
DAQPRAPYCSDGQGDLQCGICSCAPGRLGQLCECSEADLSSPDLESGCRAPNGTGPLCSG
KGRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGHCQCGVCHCHANRTGRACECS
ESVDSCVSPEGGLCSGHGDCKCNRCQCLDGYYGALCDQCLGCKSPCEQYRDCAECGAFGT
GPLAANCSAACADVNVTLALAPNLDDGWCKERTLDNQLFFFLVENSARGVILRVRPQEKG
ADHTRAIILGCVGGIVAVGLGLVLAYRLSVEVYDRLEYSRFEKERQQLNWKQDSNPLYKS
AVTTTVNPRFQGGNKQSLSLPLTQEAD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]