dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G6F6J8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G6F6J8|G6F6J8_LACDE) Uncharacterized protein {ECO:0000313|EMBL:EHE89121.1} KW=Complete proteome OX=1042400 OS=Lactobacillus delbrueckii subsp. bulgaricus CNCM I-1519. GN=LDBUL1519_01088 OC=Lactobacillus.
Sequence length 720
Sequence
MKKTTNLGKIKSRAHGYRFTVGRILELVVALVFLFLAGRMLYLSISKTIDGQDISKRTAA
IYRRNTVLTANRGTIYDKNGLIIAQDSHTYTVYAILDKTYVDSNKKPLYVQDKEKTAEKL
VTVLPLSKAKILKYLNPKNKNTFQVQFGTAGSGLTLTEKKKIQAMHLTGIKFMETPSRLY
PNGVFASNVVGYTVSQNNSKTQTTELEGVTGLEAYFNKILKGTNGYETSMVDSSENQLPS
GFHSYKAAKDGDNLYLTIDSQLQSALETYMSKVQKNYKPKAMTVVIENLKTGKILAASQR
PTFNSQTKAGISEAGSNLLVQSSYEPGSVFKILSLAAAVNSGNYNPKSYYRSGSITVSGS
TIYDWQKSGWGTIPFSQAFPRSSNVGMVYLEKKIGAKLWRKYLNMFRITHKTGITLPGEV
SGSLSFSSPVDQAVTSFGQGVTVNVMQMMQVYSALANNGQMVRPQLVEKITDSSGKTIKS
YRVQKVGKKIFTAQTRKVVMQNMKKVLDKEIGTGHIYYMKGKDFGIKTGTAQIAKSTGGY
MTGDRDYVFSVVGITPTANPRYCIYLTMKQPSKLGSGAETILAQIFKPMMSRLVLLNKGD
KSASAVVKVPKFTGMTYAKAKKTATSNGLSLVRLGTGSKVLSQKAGAGETVSVGSTVFVL
TSRKISLPDLTGWSESQIEAYASLAGIKLQLSGSGKVKSQSLAQGTVVKSGTKLKVELKE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]