dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H0Y4T0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H0Y4T0|H0Y4T0_HUMAN) Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 {ECO:0000313|Ensembl:ENSP00000393893} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CMTR1 OC=Catarrhini; Hominidae; Homo.
Sequence length 156
Sequence
XGKAQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVY
RLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFK
KKFFYNKKTKDSTFDLPADSIAPFHLPSLACLSKMD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]