dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

I1IDC3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|I1IDC3|I1IDC3_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK01079.1, ECO:0000313|EnsemblPlants:BRADI3G53760.3} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g53760v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence length 194
Sequence
MARLYVGNLDARVTAGELEDEFRVFGALRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG
KNGWRVELSRNSSGRGGGRDGGGGGRDRHGGSESKCYECGESGHFARECRLRIGAGGLGS
GRRRSRSRSRSPRNRRSPSYGRRSYSPRDRSPRRRSVSPARGRSYSKSPTYNRGRDDSPD
AKGNDGTRYRRSRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]