dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

I3J2P1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|I3J2P1|I3J2P1_ORENI) Guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 {ECO:0000313|Ensembl:ENSONIP00000003131} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100703259 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence length 374
Sequence
QIVVYSEYLKIVTTSDLEFEEEESMGAGASAEDKKSKELEKQLQEDADKESKTVKLLLLG
AGESGKSTIVKQMKILHQGGYTKEEQLEFRAIIYGNILQSALAIIRGMEMLGIDFGSSSG
QEDSQKLQNLSDSIEEGTMPPELADVIQKLWKDSGVQAAFERAAEYQLNDSAGYYLNEMD
RICKPEYMPTEQDVLRSRVKTTGIIEEQFSCKELHFRMFDVGGQRSERKKWIHCFEGVTC
IIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRFFALTSIVLFLNKKDLFEEKIKK
VHLSICFPDYDGPNTYDDASNYIKTQFLELNMKKGVKEIYSHLTCATDTKNVEIVFNAVT
DIIIKENLKDCGLF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]