dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

I3YKC6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|I3YKC6|I3YKC6_ALIFI) Uncharacterized protein {ECO:0000313|EMBL:AFL77444.1} KW=Complete proteome OX=679935 OS=46020 / CIP 107999). GN=Alfi_1090 OC=Alistipes.
Sequence length 506
Sequence
MKAMMMKKQNVGNACGWAGRLARLLLLPALTLVLLCSCDEDKAKSERPEEGDQLWKIVPV
LASESDGFEGLGEYGVSLYLFNDMSSDCYKYQHADSFGDLEPFVVEKAAYSLVALMMDRD
VPHVFYEASDEAKKNTTVTVTDMNETIPDMVLGTASVSRNVGATVPVSDLQRLVGALDVR
LTDVPNDVTAVELTVGDLYDRVDLTGQYDFSTGEPASKRIELTKEGTVFSARSVLMPSDE
TRANVKMDFRVFRGDAYEDFVVRLSGSIPADKLTRLEGRAEEILKNAELTLGLTYAPWDA
SITIEDHFQTDDDLNKVWSSAPLPISGAADPGYDNFWASSVFTDWDGSVKYDSYLYDGIM
DGSDEHKDLYWGPDAVGEAEKGTVPSWYVDLGTGCQGITLTYWNKFGGKGGQKLRTMNIY
GSNAPEDYRGGNESWTLITTFTSDRTKPTEDAGAEVTTGRIEFDKGNATYRYVKCEITSR
VNADGNVVEDSDVNVAEVQITVWSCK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]