dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

J3QJZ5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|J3QJZ5|J3QJZ5_MOUSE) Putative ATP-dependent RNA helicase DHX33 {ECO:0000313|Ensembl:ENSMUSP00000136782} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Dhx33 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence length 47
Sequence
HRKAPPRWLPFNARPSSVRLPALFAAASSLSRGPKGLSQSDHFNQHR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]