dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

J8VAG2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|J8VAG2|J8VAG2_PSEPU) Putative Clp protease {ECO:0000313|EMBL:EJT83830.1} KW=Complete proteome; Reference proteome OX=1218169 OS=Pseudomonas putida S11. GN=PPS11_29826 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 183
Sequence
MARHIVHFTGPINSSTCGNLINTCSRALQQGADVLQLNIATMGGECSYGFTLYNFLRALP
VEVHTHNLGTVESMGNIIFLAGERRTACSYSKFLFHPFHWTLHGSVDHSRMAEYAMSLDY
DLRLYAQIVAERTEGADEVLDVPRYLMAYPRILGPREALANGMIHAIDEMPIEAEACQWS
VHA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]