dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

J9YXK1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|J9YXK1|J9YXK1_9PROT) Uncharacterized protein {ECO:0000313|EMBL:AFS47661.1} KW=Complete proteome OX=859653 OS=alpha proteobacterium HIMB5. GN=HIMB5_00009090 OC=Pelagibacteraceae.
Sequence length 242
Sequence
MNFSLEIGPHTDLSTLPAVKDVYVTLLPGGDYKETAKKSGDLVKEGFNPVPHVPARSISN
DEELKDYMNMCKDLGVKQALVIGGSREPIGKFDSSFQILETGYLEGIKIGIAGHPEGSPD
ISDQDLEKAMIDKKPYADYIVTQWLLDTQPIIDFISKQSVPVHVGITGPMKISSLIKFAN
IVGAKNSINFLKSNFSKALDLLKPKDPNDLIGKVKSHTDNFHIYTFGGLKETNKWLKENK
YV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]