dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K2DB75 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K2DB75|K2DB75_9ZZZZ) Phenylalanyl-tRNA synthetase subunit beta {ECO:0000313|EMBL:EKD94771.1} OX=717931 OS=groundwater metagenome. GN=ACD_25C00234G0003 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence length 620
Sequence
MNVLIPFSWLKDYVKTNAGIRDVAKALSEHSFSVEKIIDDDTLEIEVTPNRGDGLSVLGI
ARELAAVLPVKGFSADWVKKSFPVKKYSGRDKLKVKISDNSLVPRFSAVVIDKVKVKESP
ALVKERLSKVGIRAINNIVDVTNYCMIELGQPMHAFDYNKITGHEMTVRESKRGEEIVTL
DGVKRVLPEGVIVIEDGDGRLIDLCGIMGGLNSEVDENTTKVLLFVQVYDPVRIRKSSMS
LGHRTEAALRFEKGVDFESVIPSLQTAVGMLTELSGGEVSSELIDLTGTVYTKKHIKIDY
EKINKIAGTEIKKDFVNSTLTSLGFVIKGSDVYVPSWRYDDIEIIEDLAEEVIRIYGYQE
LPNELPGGTLPHHTKTDNFALEDKTKDFLKHMGFFECYNYSAVPGSMAGHGALKVKNPLN
ADLEFLRTSLTPKLLDVLNKNKGYSETVKLFELSSVYLAKKGDLPEQPYMLGMVARGVDF
LVFKGIVEALFEELGVTGDFPYEITEHSGAIISCELPFDKMVDSAGGSRVYSPLTGFNSI
KEDITIIVGDATSFSEIVSVVSSTDVRVNKVGFKDMYEDALTLSIEFLDRAKQITSEETK
GIRDAIIKNLDSKYGIKLKV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]