dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K4LG53 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K4LG53|K4LG53_THEPS) S-layer/PKD domain-containing protein {ECO:0000313|EMBL:AFV10955.1} KW=Complete proteome; Reference proteome OX=1089553 OS=Thermacetogenium phaeum (strain ATCC BAA-254 / DSM 12270 / PB). GN=Tph_c07230 OC=Thermoanaerobacteraceae; Thermacetogenium.
Sequence length 1527
Sequence
MKQKGRRICVLALVLSLLLCGSAYAAAVLFPDIKGHWAEQTIIELAEKGVIKGYPDGTVR
PDATITRGEFIALLARNHKVDTAAAGREPPTFDDIAGHWSEKNIEALVDRGILDPADYGG
GLKPDEPITRIEIIRMLVRAIGKGEEAKQTTDNTGFADDKSIKSSDKGYVNIAIRYDLVK
GYPDNTIRPEGKTTRAEAFTLLVRQDEVLEKIRKKAEKEGEKKPPSGSSGGGSASYPRAQ
VAFELPAAAHTDTSITVTPVLKYAKTLAWSLAKEAADGSAQPLDLAEAVSGSLDKEGGTI
VFKESGSYTLTASATNYDGKTTSCSQHITVYPVVGIAFELPQHTHTDKTVSIEVATTGLG
NLDIVWSATKDGEAVAWDTAIDGDLSNEGGTITFKEKGGYGITATVTDDTGRSFSHSSSI
TVYPVASVDFELPEKAHTDTTIDLITTLSEMDGLSINWGLTRNGEVVAIGDYLEGELTNA
GGAIRFKEKGVYALTATVTDATGREYAATSETTVYPVGVAGFYLPEITHTDKVVTVKASF
ENIDAATAVWTLTRNGAPVTLGDYVEGTLTSNGGSIRFKDKGEYILAAAFTDPAGRTYGY
SLPVTVYPVPSLSFQLPATAHTDSDIKVDTTSAELDGLTVEWLVDNTYGFQDWATYVDGK
LDNDGGTIRFKHAGVYELVARTTDAAGRVFLFENGSKTEVHPVLNIRFSLPEATYPDRTI
DLRTSGNIGVLPVEWSVSKDGIAVPFDACVEGALNAQGGKIRFTQAGQYTLTASMTDALG
RTFSYTDSVAVYPIPEIQLALPQTAYVGEAAAAAVSGSDLKNLAAAWTISASGGDSKPYT
DYASGDLSNLGGSVTFKTKGDYVLTVTMTDELGRAFSQSKAITVYPIPEIQLTLPQVGYA
GETTSVSVSGNDLENLNASWTISKDGGEAKAYTDYAGGSLTNEGGSITFKAKGSYLLTVT
MTDTLGRSFARSEAITIYPIPEIQLNLPQVGYVGEAASVSVSGSELDNLTASWSISKDGG
DSKPYAEYAGGSLSNVGGNIAFKAKGGYVLTVTLTDALGRTFSQSKAVAVYPIPDMQISL
PQLTYSGEALPVTVSGNELAGLNMVWRISIDGGALAPYTQYAAGTLGNSGGEVRISTDKT
ITVKFTAVTNDENGRSFTFASNTAAIKPIAQIPFSIPSSVHVGTSFTVAMGNVSGLEGKS
ITWSLTKNGGAASYTGTLTNGGGGISIGATGTYTLMASVTNDVGRTFTHSENITVTNTAP
NKPTASATVTRTAKDGKLLVNFAVSATDPDGDAVTYEYSGQSADGYYAVGSYTVKVRAKD
TYGLYSDWTTISFTVANSEPNTPVITRTPDGNSVPPGTPVTITASSTDPDGDAITYVWEG
RPAQTSTYPLGKNTVRVKAVDAVGAESPWTAIVFFVADSTNGGGMTLTGPESVILEEGIE
GATIIEYTFTVPPVSGHSGSDYGRVRGYNKNTRQWDQLDYQTTTNGITFSRTLAPGVYTQ
LEFYYYTNHTCMYNKSNITYSVKYYFE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]