dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9PPM2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9PPM2|K9PPM2_9CYAN) Tetratricopeptide TPR_2 repeat-containing protein {ECO:0000313|EMBL:AFY35345.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_4995 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence length 137
Sequence
MKCPVCGAVYRPTKGSRETGKDEELVSISTSSPSPTCRRCKADLSDLFHIHDHAIWYHRQ
ALHLLSQKLYPEAATYNNQALVLYYSNADFHTLAGKLSALQGEWREAILSWQQALKFDPQ
NAIASNCLQMIELMTRN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]