dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9T2K2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9T2K2|K9T2K2_9CYAN) ADP-ribosylglycohydrolase {ECO:0000313|EMBL:AFY77112.1} KW=Complete proteome; Reference proteome OX=118163 OS=Pleurocapsa sp. PCC 7327. GN=Ple7327_1759 OC=Bacteria; Cyanobacteria; Pleurocapsales; Hyellaceae; Pleurocapsa.
Sequence length 314
Sequence
MRYSLLSRFQGGLLGGFLGEILIGSSSKREGMIVSEIGIDSIEPWLASGTLSAEDWEQIG
ARLSTTLEGKTPTNGGELAVAALPILFFFHDDLGLLKEQLQHLVNIWQLSAQTLEDVLIW
AYAIALALREKLDPDRLLSQILARYRLAQTPLMDQLEQVRTWLEQGTSLRQAIAQISKGG
KPNPIVLALYCFARTPEDFRLCLMQAIRTGKQASLVAALTGALAGAHNSFSGIPIDWRVA
VGKHPTGQKLTREVTCLFAAWSGAYRLEGLDTLESAAVTSPLVMQPRSSLKIISQGEYSF
LDPLFNVDSKVIKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]