dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9XK29 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9XK29|K9XK29_9CHRO) Ion transport 2 domain protein {ECO:0000313|EMBL:AFZ32980.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_4542 OC=Chroococcaceae; Gloeocapsa.
Sequence length 295
Sequence
MTQKKRRSSRVVRIVNKDGRLNIVGSGKWYSYWRDPYHLLLTVPWTGFLAIVTLGYITAN
TFFALAYLVGGNGIANARPGNFFDAFFFSIQTMASIGYGAMYPQTLYANILVTIESLLGL
MGLAMGTGLAFARLSQPTARVIFSRVAVVDLYDGVPTLMFRTANKRRNQILEAELRVRLA
RDEVNAEGLSMRRVYDLPLVRSQNPSFALSWTAMHPIDESSPLYKATPEILAQQEASIII
TLIGIDETVSQTIHARHVYIARDILWNMRFVDIMLRTLDGDRHLDYSRFHDVTPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]