dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9YZ61 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9YZ61|K9YZ61_DACSA) Dipeptidyl aminopeptidase/acylaminoacyl peptidase {ECO:0000313|EMBL:AFZ51418.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_2858 OC=Dactylococcopsis.
Sequence length 633
Sequence
MTATTTPSTQTQLPPLIPRSLLFGNPKRARPRLSPDAKYLAYIAPDEKDVLQVWVRTIGQ
TDDRQVTADKKRGIRAYFWTYKPDQLIYLQDSDGDENFHLYAVDLEKNIVRDLTPFQGVK
AQLIDLDPETPDQVLVGLNLNNPQKFDVYRINLNNGAVEFDSDNPGNIVSWTADAQFTIR
AAVAATPDGGSDLLYRETPDQDWETLRHWSADDEGGALSFSKDGKTLYIVGSHEANAQRL
LSLNLDSREETVIAADDQYDVGDVLIHPTKRHIEAVSFYKDKEEWQVLDEAIAKDFEVLR
QLRDGEFGIASRDLADKNWLVAYLTDDGPVYYYHYHRDTQNAEFLFTNQPELEDLPLAKM
QPTSYQARDGLTIHGYLTTPVGVEAKQLPTVLYVHGGPWARDTWGYNPAVQWLANRGYAV
LQVNFRGSTGYGKDFLNAGNREWGAAMHDDLVDAVEWLKAQGISDPDRIAIMGGSYGGYA
TLAGLTFTPDVFACGVDIVGPSNLVTLINSVPPYWKPMMSMFAHRVGDIETEEEFLKARS
PLFFADRIKKPLLIGQGANDPRVKQAESEQIVAEMREKGKPVQYALYTDEGHGFARPENR
MHFYAIVENFLAEYLNGRAEEIGEIEGHSGIVS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]