dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

L0PFG0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|L0PFG0|L0PFG0_PNEJ8) Uncharacterized protein {ECO:0000313|EMBL:CCJ30952.1} KW=Complete proteome; Reference proteome OX=1209962 OS=agent). GN=PNEJI1_000435 OC=Pneumocystidomycetes; Pneumocystidaceae; Pneumocystis.
Sequence length 271
Sequence
MVASIYHLIENSPPGEVNDVLNDIRILTNNDKTFFEEILPSLTKYNMEQFTNVRIPGSDS
EVTIVSKFNSNEDGWFFDPILKKSFQFDHINLKVLDVKSYETDIKVIEKITGLQKPLLAY
LSEHFPSNVNYGIFPCKNDIYNIIIVGNKYNPVNFWNGRWRSFYQFSESSLTITGTLLID
VHYYEDGNVCLTTRQTLSFEAKSLDCYDIITAIAAEEKKYQEELNTAFSGLNDYDFKSLR
RQLPMTKQKMNWENINTLKIGQDVTGRSQTY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]