dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

L7FLJ8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|L7FLJ8|L7FLJ8_ENTIV) Uncharacterized protein {ECO:0000313|EMBL:ELP88744.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_104770 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence length 139
Sequence
MVQSKSYKETLEANNTEINIADLEQQVQDLEERPVVTSNIDQTEVIKRDNQIADLEKAVA
ALKEQNTRLDAAKKDMKKQSVEDASKIKNYESQIKAFEAQKKMALDDKTEDEKTAADQSD
RRKKMEDQVKAFNAQVLSL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]