dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M0RWN8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M0RWN8|M0RWN8_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr1P03300_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN=103976648 OC=Musa.
Sequence length 210
Sequence
MAVPGRRNGVMDEEDDEDDVLFDDGDALADLDLDSDVPPHLRALVEAAESGNVDALRSAL
DNHTGSIDEPVEDGDTVLHLSCLYGYFPCVQLLLERGASLESKDEEGAIPLHDACAGGFT
EIVQCMLNSAGSPDFVMQLLSATDIEGDTPLHHAARGEHLDVVKLLLAAGASPKKTNIYG
KIPAELADQETEVRSILIAATASADEVSCQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]