dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M0S9T4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M0S9T4|M0S9T4_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr2P20930_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence length 761
Sequence
MAVFSHSTGRGCGGGGGSGGRGAAAASQRLVEAAQRGDVRAAAECLADPAVDVNHVGAVC
LRGRRVEVALREEAADEVRVEWEELRTDASALFLAAQAGDLPFVRTLLEKGADVNQKLFR
GHAITAAVREGHAEVVEVLLKAGASQPACEEGVVEASLHGRARLAELLMGSDLVRPRVAV
HALVSAASRGFVDVVDGLIKCGVDANATSRLLLRSLKPALHTNVDCTALVAAIVGRQAAV
VRRLLQAGARMDAKVRLGAWSWDAATGEEFRVGAGLAEPYTPAWCAVEYFESTGTILRML
LQHHSPNAPHHGRTLLHHAILCGNPRAVDTLLSCGADWELPVRAGRKTEFRPIHMAARLG
LASVMQVLVDKRCDLSSTTDAGETALMLCARYKRGDCLRILASSDADLGRKSLAGASAAA
IAASSNWSVGFQHAVLDVIRSGTVPRSSDPSVFSPIMFAAQHGDVASLQVLLTQPDINID
QRRGNGYSPVMVAAKEGHVEAFRVLVFAGANVRLRSEAGETAIDLFRLNENHDMFEQAML
ELALEKGSAGGFHALHFAARRGDMAALRLLTKTGWDVNALDGDGYTPLMLAAREGHAEAC
QLLILQGARCDVETRRGETALSLARSNAKLGKEAESVILDELARVLVVRGDHVKKHTRRG
KGPPHGKVLRMVAAAGVLRWGSSGRRNVVCREAEVGASPAFVRNSKGRGDAREPGLFRVV
TTRKREVHFVCEGGEAAAELWVRGIRLVTRAASGKGGSELN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]