dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M1FG77 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M1FG77|M1FG77_9ALTE) Putative acetamidase / formamidase {ECO:0000313|EMBL:AFP29353.1} KW=Complete proteome; Reference proteome OX=490759 OS=Marinobacter sp. BSs20148. GN=MRBBS_0415 OC=Alteromonadaceae; Marinobacter.
Sequence length 315
Sequence
MCQQTLVKTIHGGHHHHGWDNSFAPVARVAPGSMVELECKDSGNGHFTTDSTVAAVSSMP
FDKINPVTGPIYVEGAEPGDILKVTIDSFRPSGFGWTANIPGFGLLTDQFQNPALMLWHY
DRNNMTPAAFGKFAKVPLKPFAGTIGLALAEPGLHSVVPPRRVGGNLDIRDLNAGSSLYL
PVEVAGALLSIGDTHAAQGDGEVCGTAIESAMDVTVKLDLIKDTPLAMPRFTTAGPVTRH
LDGSGYEAFTGIGPDLMQAARDAVSGAIDWITREHHMPPEQAYMLCSVCGDLRISEIVDM
PNWVVAFYVPRLVFE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]