dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M5BBB2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M5BBB2|M5BBB2_9MICO) Endoglucanase, glycosyl hydrolase family 26 {ECO:0000313|EMBL:CCE76583.1} KW=Complete proteome OX=1097677 OS=Clavibacter nebraskensis NCPPB 2581. GN=CMN_02651 OC=Clavibacter.
Sequence length 461
Sequence
MPTRRRLKCAVVTAVAPAVVTATVLVAPAAGARAASAQAAPTAPAATVLSVASGPVGTPV
TVTGTGFPAKKAAVVAVGSTTKRITTTATGRFTTAITIPRTSLSTIRITATAGTRSAGAP
FTVTTAKSNGSARLGASAPAPTTTPAPAPTGAPTSTAAPAPATSSPAPAASAAPAISSAR
LRLGLSTPGGPTANGELDAASTTLGESPSIVMSHVDFTHPAPIAGLRSVAARGADSLITW
EPWQGGAGVDQPAYANARIVAGDYDSYIRSWGADLAKYGQPVYLRFGHEMNGNWYPWSDG
VNGNASGSYVQAWKHVHDLVAAQGATNVKWVWSPNVPYPGSTDLASLYPGADQVDVVALD
GYNWGAVPGQRWTAPADLFGPGMAQLRAVAPGKPLIIGEVASGETGGSKADWDRDLVAYL
QSQPDVLGFVWFDFKKEEDWRIDSSAASATALRDALALRRG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]