dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M8AZ83 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M8AZ83|M8AZ83_AEGTA) B3 domain-containing protein {ECO:0000313|EMBL:EMT09782.1, ECO:0000313|EnsemblPlants:EMT09782} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_16402 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence length 644
Sequence
MGLEPISNFSRSCGSLYNYTEFGGASCQDEFQVLDLLHCWLVERSDWNAGCTLALEQQHC
NPGAGIFDNPVHGTGLAASQMEKLCDCCKRYADHLDEKMKCFRRHMGADFRHGMIIPKKF
IDNFGGMISRTIELESSNGNMYVFEVSKRMGNTVLHRGWQAFIDEHHIEENDSLLFRHIE
KSRFEILVLDSDDCEKVFFCPGINIVSNVEERGADSVNISNSSRDYATRSSGSKRLCTGE
DTENENTDAIYSSSEDSEEGTEDIPSEHESSFELDDGHTPSRQDYVLARGRTLSRVQDEK
VTTLIQDVGAEIPVFVAVMKPSNVKSQTSALVIPKGYAVEHFPPKSQTVTLQRPGKSKKW
HPRFHIRKDKHGSILCGPGWFDFVRDTRVQVGDICIFERMMKKGTGRTFSSLRVHLLRKS
MLHSGGSGTGPKRVSLTHGKTRVNSATPKGARTTDGRTRAKATSTASVRKEPGDEMFPGG
NAPSSVHSHGHEARQGPVESNKSRGPRKRPYIISSTACLTREQEMNVDKRARSLQSDVPI
YASVMNKSSVGDNSLYAVTICRKYAAEYLPAGAQTVTLLRAEKSKTWEVKVNPRIGNAKM
LKGGWREFAHDNHLKLKDICLFQLMTDQRKLTMMVDIIRHNEKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]