dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M8BV75 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M8BV75|M8BV75_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT25849.1, ECO:0000313|EnsemblPlants:EMT25849} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_18417 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence length 536
Sequence
MTPAPRNPFSPGFLHADAHAAQSTPVPTSPDGIFQRYLLPLKKRATTTSDGSSADDSFVV
PPKKRRVVDTVGEGTGSCAIPVQSRPRRSAACNVAYVSMEEDEAGTSAAGAKKNRNRNRN
SNGNRKNGPQPARDAAPLVNRPLHLSEAQRQRPETLGATAPQFVIMKSLQMSDVDRNQNR
LLFSCKREFLEGHPITGILAEKETRHVHHHRGLSVVVQDDHSNQFNFTLKYLDSNGGYRF
IGTGWNDFVSKNKLVKDDLHFVIEVWAFRSPELPGQPKVPGIEGLQGHPDGALGFLLRLH
HDESRDVHRGGEEEREFAPRPVKQKKRQAPAKAVRSKKQLAGAHVSQGEAVARDVTRAEI
VEAVGEEMADALFGLLMLRSSAPVPMPPFENTTCAKMSLGTKMPYSITTHHSRGTTLLKY
FAPARHHSLDTSLILATRTPTGTAVLRNTRAFLSFQISHEISIMRDIIGRLDCDILESIR
FHQAFTEWIAIQAEGCTSTKPSQDLIIPKLEPCSGIGTVGGTRILELVCIGGNGRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]