dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M9PFT2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M9PFT2|M9PFT2_DROME) CG3634, isoform C {ECO:0000313|EMBL:AGB94818.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG3634 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 537
Sequence
MWDSSMFLSTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSINHISPWING
SDGQSESSNGSGSSSSSGSSSSSNGGAGGGGSGGAGASGSGSATTSTGTQMPECKVWRNP
LNLFRGAEYQRFFWATSKEPLTYYDMNLSAQDHQTFFTCEGDARKEEYEIMQTAWRERNP
MQRIKSAHSALEINAECAPAYILLAEEEAMTIMEAEKILKTALKVAEINYRKSQATQHQG
AIADGMHRRDTNVLIYIKRRLAMCARKLGKLKEAAKMFRDLTKEIPSIMSVLNIHENLIE
TLLEMQAYADCHAILAKYDDISLPKSATICYTAALLKARAVADKFSPDIASKRGLSQAEM
SAVEAIHRAVEFNPHVPKYLLETKRLILPPEHILKRGDSEALAYAFFHLKHWKQVEGALN
LLHCTWEGTFRMLPYPLERGHLFYPYPTCTECADRELLPAFHEVSVYPKKELPFFILFTA
GLCSITALLALATHQYPEPMGHLAQTVLTWISYPFQLLKERIEAFWPCNLLQQLSRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]