dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M9U291 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M9U291|M9U291_9ACTN) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome OX=1265601 OS=Streptomyces sp. PAMC 26508. GN=F750_6416 OC=Streptomyces.
Sequence length 271
Sequence
MSETTPNSKGPAKVQLSPEQVAGLGLASAPGATTSDVSVAPLEKRLEVRSASAALDFIMT
TEGHLDELTSVLQRMRVLSLQSANGTYSEEDRSATQAEFDQLFGEIARIADQADLNKVRM
FDDASAEGNVRGADELGMMPAKTNTPASLASAQASWTLRVHMGANADEALTVNVLAADIQ
HLFASEGATPADQGAAAPADQQGRVAVEGPVNVLTAIDANLSLAKIDVAIRTVTAQRSNL
GAFSNRLESAIRRGEYAVENLTASDTAIERA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]