dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

N2A0Y3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|N2A0Y3|N2A0Y3_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:EMZ19680.1} KW=Complete proteome; Reference proteome OX=97139 OS=Clostridium sp. ASF502. GN=C824_06018 OC=Clostridium.
Sequence length 326
Sequence
MRKWKGPGKGLGVLLLTAALVCGSVQPVFADGDGADSPSTEVQEKKADGEITPGGDLTGG
TNTNAEAVAAEAAGENKDKKDPGNALSDGENPDAGTTDQKKTDADTPEDDASKKEATEVN
APGTKTNTMEGTEKASSELTKDVKDNDSETKPLAANNGDPVVAVDSVTWEGGLLKVPVDL
GGYTADEILPVLRFAPENTDTYTTLRYPTLEDGYAVYSPISDFYRYRNSVNTFWTEKGSY
DVTMEFHLSDSSEDLICTDAFTLTIPLDSKMWQVEEKVVEFDGSQDITFSFTNGTNYCEL
ESISYVELFLLKGQGGSVSLGNGGFT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]