dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q17J03 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q17J03|Q17J03_AEDAE) AAEL002184-PA {ECO:0000313|EMBL:EAT46589.1} KW=Complete proteome; Reference proteome OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN=AAEL002184 OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence length 275
Sequence
MTEQQMDCALDLMRRLPPQQIEKNLIDLIDLAPALCEDLLTSVDQPLKIAKDKETGKDYL
LCDYNRDGDSYRCPWTNTYDPPLEDGSMPSERLRKLEIEANHAFDQYREMYYEGGVSSAY
LWDLDHGFAGVILIKKAGEGNQKTKGCWDSIHVVEVQEKSSGRTAHYKLTSTAMLWLQTH
KQGSGTINLGGSLTRQVEQDAPVGESSPHIANIGRLVEDMENKIRNTLNEIYFGKTKDIV
NGLRSIQKLADTNQQASMKKELALALLRRTGKGEN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]