dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q1MPV3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q1MPV3|Q1MPV3_LAWIP) Membrane proteins related to metalloendopeptidases {ECO:0000313|EMBL:CAJ54974.1} KW=Complete proteome; Reference proteome OX=363253 OS=Lawsonia intracellularis (strain PHE/MN1-00). GN=LI0920 OC=Desulfovibrionaceae; Lawsonia.
Sequence length 299
Sequence
MFFGNYHIILLKEKNGTSKNLYIKGWLGSSLCIFLGVVIISNILLWQQYQNTNILQRQLS
ESERTIETQNTQLMGLVGKISSLQEDLSRVQRLDSKLRVIVNIEKDIEATSIGGSRTEEF
SRTYLPLHRQELMVRKLNNFLKQLSEEVRLEEVRQQELLQTLRDKKEALASIPSIWPISG
FITSHFGNRPSPFTGRIEYHKGLDISAAIGTPIQASGNGRVILAGCDGAYGNCVVLQHGS
GLTSRYAHMSTVDVKVGQNVRRGQIIGYVGSTGRSSGPHLHYEVKVNGMNVDPLRYILD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]