dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q3SKE6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q3SKE6|Q3SKE6_THIDA) Uncharacterized protein {ECO:0000313|EMBL:AAZ96837.1} KW=Complete proteome; Reference proteome OX=292415 OS=Thiobacillus denitrificans (strain ATCC 25259). GN=Tbd_0884 OC=Thiobacillaceae; Thiobacillus.
Sequence length 122
Sequence
MISLDVDQNLIAVTVMGQFTLADYREFEEAVAHGIAFEGKVNLLFDLRDMLSYSVDVAWE
ELKFSREHKNDFGRIAILTGDEWVAWSMWVNRMFMSADIRLFDELEAAQAWVTGGELPAP
VI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]