dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q3SU48 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q3SU48|Q3SU48_NITWN) Sugar isomerase, KpsF/GutQ family protein {ECO:0000313|EMBL:ABA04193.1} KW=Complete proteome; Reference proteome OX=323098 OS=NCIMB 11846 / Nb-255). GN=Nwi_0931 OC=Bradyrhizobiaceae; Nitrobacter.
Sequence length 325
Sequence
MIDQANIAIESALRTFEAEAGGVSALAAALKSDLGLAFAAATDLIRNAKGRLIVTGLGKS
GHIGRKIAATFASTGTPAFFVHAAEASHGDLGMITADDVIMALSWSGEQPEMKNLITYAK
RFRIPLIAMTAERDSTLGKAADVALVQPKAREACPHNLAPTTSSLMQLALGDGLAIALLE
GRGFTSVDFSVLHPGGKLGALLKYTRDLMHSGDAIPLKPLGTKMSEALVEMTSKGFGCVG
VTDGQGNLVGIVTDGDLRRHMRPDLMTARVDDVMTPHPKTIGRDLLAGEALEILNSSKIT
ALIVTEGKKPVGIVHLHDLLRAGVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]