dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q488U4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q488U4|Q488U4_COLP3) Oxidoreductase, GMC family {ECO:0000313|EMBL:AAZ28564.1} KW=Complete proteome; Reference proteome OX=167879 OS=psychroerythus). GN=CPS_0670 OC=Colwelliaceae; Colwellia.
Sequence length 534
Sequence
MYNYIIVGAGSAGCVLAARLTENPNITVCLLEAGGPDKSVFIHAPAGVAAMLPTKINNWA
FETIPQKGLNGRKGYQPRGKTLGGCSSTNAMLYVRGNKWDYDNWSALGNKGWSYEEVLPY
FKKSEGNEYFSDQYHNQDGPLGVSNATAASNTNEMFIASCQEQGLKQNDDYNGAEQEGCF
MYQRTVKNGERCSAAKAFLTPHLNRPNLTVITHALTEKVLFEGKKAVGIRYKKDKKSVDI
HCDKEVILSGGAFGSPQVLMLSGVGPKEHLSDKNISLVHHLPGVGQNLQDHIDYIQTYRV
ASSDETFGLSLQGGTSMLKWMFEWKNKRSGKITSTLAESGAFFSTQDNVVAPDAQLVFVP
GIVDDHARKVNFGHGYSCHITVLRPDSTGEVKLNSSNPEDSLAIDPKFFDNDKDLDLIKR
GAKKMRAILESSPFDGIRQKLLFPLEKGNEHALEQDIRNRSDTQYHPACTCKMGTEYDAM
AVVDEQLKVHGLNGIRVVDASIMPKLVSGNTNAPTIMIGEKAADMILADYEDSQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]