dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q48AQ0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q48AQ0|Q48AQ0_COLP3) Uncharacterized protein {ECO:0000313|EMBL:AAZ27474.1} KW=Complete proteome; Reference proteome OX=167879 OS=psychroerythus). GN=CPS_0095 OC=Colwelliaceae; Colwellia.
Sequence length 470
Sequence
MMKQHLDALKDSKYCPLWHDQDIRPETLPALSADTSCELLIVGGGFTGLWGALQAKERQP
DADIILIEKTTISDGASGRNGGFLSSSLAHGETNTDHQFPGEADKLHQLGQQNLKEFIET
LEHYNIDARYEKVGETSVATDQASVDALRATYESEKAQGEDVVWFNQEEMQAQVNSPTYL
AGLWYRGGQDGVVDPARLCWGLKRVILELGVRIYEETPLTSLKKLGQDKMEVTCSDVKII
SDKVLMATNAYRNPIGQARRSIIPVWDYQIATQPLSQEQLDSIGWHKSRHALSNHANMFH
YYRFTKDNRITWGGGGAVRYYFNNGIDQSYADIPERFAQLSEEFFETFPQLKGIKFTHRW
SGIIATSTRFCVVPGVAYDGRVAWAIGYTGLGVGASRFGARIGIELLGYKPSEILDMQFV
KKKPIPWAPEPLRWIGVYLTHKALEKADANGGKRGLWLKLLDMLNLGFTC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]