dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q4V794 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q4V794|Q4V794_RAT) Vacuolar protein sorting 37 homolog A (S. cerevisiae) {ECO:0000313|EMBL:AAH98069.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_59095 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence length 398
Sequence
MSWLFPLTKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVSNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFPFLPSYPPQEAASRSITSLSVADTV
SSSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASINQNGFGYKMPDIPDAFPELSELSV
SQLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKSIEELARKNLLLEHSLETKRQAVLD
KYELLIQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEI
DDFLNSFKEKRTICHCRRAKEEKLHQVIAMHSQFHAPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]